(data stored in ACNUC7421 zone)

EMBL: CP001825.PE474

CP001825.PE474       Location/Qualifiers
FT   CDS             complement(532244..533374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0477"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   xca:xccb100_3196 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41398"
FT                   /db_xref="GOA:D1CEP2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41398.1"
FT                   /translation="MTPNAQSFEVQERERLVRIYRSLTGDPDTAEDLAQEAIIEAWRNK
FT                   HKLHDPSGRWRWLSNIARKVYLRWSRDRARDYRRMEIVGQDLSNRLELMEDPELSIELE
FT                   REELATILDEALRHLPAETRSILLQHVVEGMPQADIARKLGISEGAVAVRIHRGKLLLR
FT                   KILLSRPDYVGIYNIGASPSSWQPTDIWCPFCGLDKLQGKLDPATDTFMMKCPTCTPSP
FT                   DDQLINGSNIGIARSYTTLNGALNKLMKEACEYYGQGLRTRRTQCLSCGTTIPLWIELA
FT                   PDSECPIKTSMHFITAICQHCQEESRSLLAGHALSLPQGRAFWKANKRIRMLPEQNVER
FT                   EGRKAAVTAFESVSRSAKYEVVYALDNYDILLINNR"
     MTPNAQSFEV QERERLVRIY RSLTGDPDTA EDLAQEAIIE AWRNKHKLHD PSGRWRWLSN        60
     IARKVYLRWS RDRARDYRRM EIVGQDLSNR LELMEDPELS IELEREELAT ILDEALRHLP       120
     AETRSILLQH VVEGMPQADI ARKLGISEGA VAVRIHRGKL LLRKILLSRP DYVGIYNIGA       180
     SPSSWQPTDI WCPFCGLDKL QGKLDPATDT FMMKCPTCTP SPDDQLINGS NIGIARSYTT       240
     LNGALNKLMK EACEYYGQGL RTRRTQCLSC GTTIPLWIEL APDSECPIKT SMHFITAICQ       300
     HCQEESRSLL AGHALSLPQG RAFWKANKRI RMLPEQNVER EGRKAAVTAF ESVSRSAKYE       360
     VVYALDNYDI LLINNR                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page