(data stored in ACNUC7421 zone)

EMBL: CP001825.PE476

CP001825.PE476       Location/Qualifiers
FT   CDS             complement(536429..536620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41400"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41400.1"
FT                   /translation="MWQAQTFMSQDEETALAEMLTWLNENEEIIVEYQAIQVHQPDGTH
FT                   VCVVAYRARRLEPQAFIT"
     MWQAQTFMSQ DEETALAEML TWLNENEEII VEYQAIQVHQ PDGTHVCVVA YRARRLEPQA        60
     FIT                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page