(data stored in ACNUC7421 zone)

EMBL: CP001825.PE485

CP001825.PE485       Location/Qualifiers
FT   CDS             545405..545716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0488"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: hha:Hhal_1848 ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41409"
FT                   /db_xref="GOA:D1CEQ3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ3"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ACZ41409.1"
FT                   /translation="MYAVIRTGGKQYKVAVGDQLSVEKLPAEAGQAVQFDDVLLVADGE
FT                   NVKVGTPTVEGALVKATVLDQERGPKIRIFKFKAKKRYRRRAGHKQNYTRVKIDEIVA"
     MYAVIRTGGK QYKVAVGDQL SVEKLPAEAG QAVQFDDVLL VADGENVKVG TPTVEGALVK        60
     ATVLDQERGP KIRIFKFKAK KRYRRRAGHK QNYTRVKIDE IVA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page