(data stored in ACNUC7421 zone)

EMBL: CP001825.PE486

CP001825.PE486       Location/Qualifiers
FT   CDS             545736..545996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0489"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: ribosomal protein L27; K02899 large
FT                   subunit ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41410"
FT                   /db_xref="GOA:D1CEQ4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ4"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ACZ41410.1"
FT                   /translation="MAHKKGVGSSRNGRDSNPKYLGVKKFDGEYVKPGMIIVRQRGTKI
FT                   RPGDNVGLGKDYTIFSLVEGTVKFTPYSKTQKKVSVVPLAQ"
     MAHKKGVGSS RNGRDSNPKY LGVKKFDGEY VKPGMIIVRQ RGTKIRPGDN VGLGKDYTIF        60
     SLVEGTVKFT PYSKTQKKVS VVPLAQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page