(data stored in ACNUC7421 zone)

EMBL: CP001825.PE487

CP001825.PE487       Location/Qualifiers
FT   CDS             546025..546309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0490"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: cha:CHAB381_0223 50S ribosomal protein
FT                   L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41411"
FT                   /db_xref="GOA:D1CEQ5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ5"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACZ41411.1"
FT                   /translation="MKPNIHPQYVEATVHCSCGNTWKTRSTKPNIRVDLCSKCHPFFTG
FT                   EQRIVDTAGQVDRFMRRLERRQAGRGGGTPVTIPAEERPTVAEAESQEQ"
     MKPNIHPQYV EATVHCSCGN TWKTRSTKPN IRVDLCSKCH PFFTGEQRIV DTAGQVDRFM        60
     RRLERRQAGR GGGTPVTIPA EERPTVAEAE SQEQ                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page