(data stored in ACNUC7421 zone)

EMBL: CP001825.PE488

CP001825.PE488       Location/Qualifiers
FT   CDS             546414..546956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0491"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bph:Bphy_1696 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41412"
FT                   /db_xref="GOA:D1CEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ6"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACZ41412.1"
FT                   /translation="MSDKPRLRQLKAKALKDFLRGVQRPEVDLVFLLQDLEDPVNVGAA
FT                   FRIADGCEASEIILTGKTPTPPDSTIAGVGRGAHRRIPWRYVEHADEALVELKGMGYMA
FT                   CAIEVAEGAVPYYSLKYPDRVCLVVGHEYHGVTTRTLSVCDNAVYIPMYGKIKSLNVHV
FT                   ALAVVAFHVLHQQLICG"
     MSDKPRLRQL KAKALKDFLR GVQRPEVDLV FLLQDLEDPV NVGAAFRIAD GCEASEIILT        60
     GKTPTPPDST IAGVGRGAHR RIPWRYVEHA DEALVELKGM GYMACAIEVA EGAVPYYSLK       120
     YPDRVCLVVG HEYHGVTTRT LSVCDNAVYI PMYGKIKSLN VHVALAVVAF HVLHQQLICG       180
//

If you have problems or comments...

PBIL Back to PBIL home page