(data stored in ACNUC7421 zone)

EMBL: CP001825.PE491

CP001825.PE491       Location/Qualifiers
FT   CDS             complement(549592..550533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0494"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bcr:BCAH187_A2274 methanol dehydrogenase regulatory
FT                   protein; magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41415"
FT                   /db_xref="GOA:D1CEQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ9"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACZ41415.1"
FT                   /translation="MSARELAEVIKQNVRRVLVGADKPTEMLLVALVAQGHVLIQDVPG
FT                   VGKTTLARALAKSIDTSFSRIQFTPDLLPSDITGAYYYNQRESQWLLREGPIFAGIVLA
FT                   DEINRAAPRTQSALLEAMQEGQVTIEGETRDLPSPFLVIATQNPIELEGTFPLPEAQLD
FT                   RFLLRISMGYPSREDEKRVLLTHSPQSIRHIEPVTSTRQILDATEEATAVTVEESIAEY
FT                   IVDLIRATREHPAVQLGGSPRAGTALLRASRALAALRGRDYVLPDDVKELAVPVLAHRL
FT                   VLTQESMLRGRSAEEILQEIIEQIQVPVEAEA"
     MSARELAEVI KQNVRRVLVG ADKPTEMLLV ALVAQGHVLI QDVPGVGKTT LARALAKSID        60
     TSFSRIQFTP DLLPSDITGA YYYNQRESQW LLREGPIFAG IVLADEINRA APRTQSALLE       120
     AMQEGQVTIE GETRDLPSPF LVIATQNPIE LEGTFPLPEA QLDRFLLRIS MGYPSREDEK       180
     RVLLTHSPQS IRHIEPVTST RQILDATEEA TAVTVEESIA EYIVDLIRAT REHPAVQLGG       240
     SPRAGTALLR ASRALAALRG RDYVLPDDVK ELAVPVLAHR LVLTQESMLR GRSAEEILQE       300
     IIEQIQVPVE AEA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page