(data stored in ACNUC7421 zone)

EMBL: CP001825.PE493

CP001825.PE493       Location/Qualifiers
FT   CDS             complement(553051..555348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0496"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: scl:sce0281 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41417"
FT                   /db_xref="GOA:D1CER1"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER1"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ACZ41417.1"
FT                   /translation="MNIKPRLFLRLCLILVLLASVAICMQSPPVKADQPEARLIINEVM
FT                   SNPITDWNHDGVVNRGDQWVELYRDGGSYVDLDGWIIDDGPGGSLPYRFDSFSTEWRYI
FT                   VVFSSQTLIDFGQAGDVVRIYKPDGSLSDELEVPEMQDDSSASRYPDGSDSIRVDLVPT
FT                   PLYPNGSRGVITPPTPTPDPTPTPESMTIDSARRSPAGKLVQIRGTVTAPPNSVGNKRM
FT                   YVQDYTGGVLVLTASSITGIATGQEVIVTGTMGTYYGEIALRPVDGGIKLTGQSYEVSP
FT                   MDIRARDIGPRFESRLVRLSGEVSASSKPDLMLVDGSTSIPARVHISSPSTVSWLSPQK
FT                   GDQLQVTGILSSVNGRYRLVPRFNSDISITRSADLPESKPINYLRTNIAFARTLSTDIP
FT                   VEVTGIVTTPPNLLGKGTMYVQDTSAGILVTGNLTRLHPGQQVTIRGRTSIYYSQHRIE
FT                   ADKIEPSQTYTQVMPRDISPVDVGPSTEGLLVRLSGAVSGSSWPSIYLNGGATRIYFAD
FT                   GTRIKNPKAEAGDYLTVVGIVSRWNDNYRVMPRFASDIILSKTIQNTQWLDTTLGALRS
FT                   LPMGTRVRFTAQVTAPPGSLGEERMYVGSGGLGIALHLTNDKYPKLIEGDVVQVQGVLD
FT                   TYHKERIVRLESGSDITRLSVGAPVQPVRVSTSKIGRDLEGALVTIAAPITARSWPSLY
FT                   MNDGSGEVVVKIDEGTGIPRFEGGKHDFAQITGIVSRWDDTWRLLPRKASDIQIVTIPK
FT                   GMPATGQGGSRS"
     MNIKPRLFLR LCLILVLLAS VAICMQSPPV KADQPEARLI INEVMSNPIT DWNHDGVVNR        60
     GDQWVELYRD GGSYVDLDGW IIDDGPGGSL PYRFDSFSTE WRYIVVFSSQ TLIDFGQAGD       120
     VVRIYKPDGS LSDELEVPEM QDDSSASRYP DGSDSIRVDL VPTPLYPNGS RGVITPPTPT       180
     PDPTPTPESM TIDSARRSPA GKLVQIRGTV TAPPNSVGNK RMYVQDYTGG VLVLTASSIT       240
     GIATGQEVIV TGTMGTYYGE IALRPVDGGI KLTGQSYEVS PMDIRARDIG PRFESRLVRL       300
     SGEVSASSKP DLMLVDGSTS IPARVHISSP STVSWLSPQK GDQLQVTGIL SSVNGRYRLV       360
     PRFNSDISIT RSADLPESKP INYLRTNIAF ARTLSTDIPV EVTGIVTTPP NLLGKGTMYV       420
     QDTSAGILVT GNLTRLHPGQ QVTIRGRTSI YYSQHRIEAD KIEPSQTYTQ VMPRDISPVD       480
     VGPSTEGLLV RLSGAVSGSS WPSIYLNGGA TRIYFADGTR IKNPKAEAGD YLTVVGIVSR       540
     WNDNYRVMPR FASDIILSKT IQNTQWLDTT LGALRSLPMG TRVRFTAQVT APPGSLGEER       600
     MYVGSGGLGI ALHLTNDKYP KLIEGDVVQV QGVLDTYHKE RIVRLESGSD ITRLSVGAPV       660
     QPVRVSTSKI GRDLEGALVT IAAPITARSW PSLYMNDGSG EVVVKIDEGT GIPRFEGGKH       720
     DFAQITGIVS RWDDTWRLLP RKASDIQIVT IPKGMPATGQ GGSRS                       765
//

If you have problems or comments...

PBIL Back to PBIL home page