(data stored in ACNUC7421 zone)

EMBL: CP001825.PE495

CP001825.PE495       Location/Qualifiers
FT   CDS             complement(556036..557001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0498"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: nma:NMA2045
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41419"
FT                   /db_xref="GOA:D1CER3"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER3"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACZ41419.1"
FT                   /translation="MSRIAIVGLDLVGTSLGLALKDWLAKQKTDSSTIPLQIAGFDYDP
FT                   DRQKRAEKLGAIDKSFWGLPSAIEDAAVIIVTGPLEEASRTIAEIIPLINWSTVITTTN
FT                   PRIADTLQIFNTYVHKEEQISFVAGHPMISLAREGSPSKELFRGMMYGVFPHSGAKAQD
FT                   IDLIVGIVHAIGAKAYFADPTEYDSQFAATSLLPAMLVAILARTVRSDSGWQDISRFSQ
FT                   TDLEQIAKFLGPFPEELATDAQNHAKDLKRWLERYHEQLGALIDSLDRDNQDTQSEIRQ
FT                   LLEQANQVRQEWGEKPGREATETTGLQDFIKRMFVGRRNR"
     MSRIAIVGLD LVGTSLGLAL KDWLAKQKTD SSTIPLQIAG FDYDPDRQKR AEKLGAIDKS        60
     FWGLPSAIED AAVIIVTGPL EEASRTIAEI IPLINWSTVI TTTNPRIADT LQIFNTYVHK       120
     EEQISFVAGH PMISLAREGS PSKELFRGMM YGVFPHSGAK AQDIDLIVGI VHAIGAKAYF       180
     ADPTEYDSQF AATSLLPAML VAILARTVRS DSGWQDISRF SQTDLEQIAK FLGPFPEELA       240
     TDAQNHAKDL KRWLERYHEQ LGALIDSLDR DNQDTQSEIR QLLEQANQVR QEWGEKPGRE       300
     ATETTGLQDF IKRMFVGRRN R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page