(data stored in ACNUC7421 zone)

EMBL: CP001825.PE496

CP001825.PE496       Location/Qualifiers
FT   CDS             complement(557017..557577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41420"
FT                   /db_xref="GOA:D1CER4"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41420.1"
FT                   /translation="MSFKKSALLLWPISALAWASIAYYIFSINIGAESDIFAVTRLLYY
FT                   GLLVIAPITAAIPICRLTDSRIFWFESLIYWAGLLYMFTFVPPDRYGLPGYLLFMVMFF
FT                   GACYTIFMPIGYAIGFRLFTLRAHKRDVNRARREAYLLALFLALSAAMNVAGLFNLINA
FT                   VLLLLILILIELFALAHKSGSEA"
     MSFKKSALLL WPISALAWAS IAYYIFSINI GAESDIFAVT RLLYYGLLVI APITAAIPIC        60
     RLTDSRIFWF ESLIYWAGLL YMFTFVPPDR YGLPGYLLFM VMFFGACYTI FMPIGYAIGF       120
     RLFTLRAHKR DVNRARREAY LLALFLALSA AMNVAGLFNL INAVLLLLIL ILIELFALAH       180
     KSGSEA                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page