(data stored in ACNUC7421 zone)

EMBL: CP001825.PE497

CP001825.PE497       Location/Qualifiers
FT   CDS             557790..559262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0500"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: bha:BH0020 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41421"
FT                   /db_xref="GOA:D1CER5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER5"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACZ41421.1"
FT                   /translation="MLDDKFALEGYTFDDVLLVPAYSEVLPSEVSTSTCLTPRISLNIP
FT                   IVSAAMDTVTEARMAIALAREGGIGIIHRNLSIEEQVAEVDKVKRSEAGMIVEPVTLPP
FT                   YAQLSDAVAIMEKYHISGVPVVDEEGKLVGILTNRDIRFETDLTKPISSAMTSENLITA
FT                   PVGTTLEEAREILHRYKIEKLPVVDDEGRLKGLITVKDIQKKIQFPMATKDEKGRLRVG
FT                   AAVGVGPAGLERAEALIAAGVDVIVVDTAHGHTKAVIDIVREIKARWDVDVIAGNVGTP
FT                   EGAEDLVRAGADGVKVGIGPGAICTTRIVAGAGVPQLTAIYNCARAVAPYGATIIADGG
FT                   IQYSGDIAKAIAAGADTVMLGSLLAGVDESPGEVLIYQGERYKEYRGMGSIAAMKQRGY
FT                   SRDRYGQADIGNVSKLVPEGIEARVPYKGPLSNLVYQLVGGLRSAMGYCGARNIREMKE
FT                   NTKFMRITNAGLRESHPHDVVITREAPNYRLR"
     MLDDKFALEG YTFDDVLLVP AYSEVLPSEV STSTCLTPRI SLNIPIVSAA MDTVTEARMA        60
     IALAREGGIG IIHRNLSIEE QVAEVDKVKR SEAGMIVEPV TLPPYAQLSD AVAIMEKYHI       120
     SGVPVVDEEG KLVGILTNRD IRFETDLTKP ISSAMTSENL ITAPVGTTLE EAREILHRYK       180
     IEKLPVVDDE GRLKGLITVK DIQKKIQFPM ATKDEKGRLR VGAAVGVGPA GLERAEALIA       240
     AGVDVIVVDT AHGHTKAVID IVREIKARWD VDVIAGNVGT PEGAEDLVRA GADGVKVGIG       300
     PGAICTTRIV AGAGVPQLTA IYNCARAVAP YGATIIADGG IQYSGDIAKA IAAGADTVML       360
     GSLLAGVDES PGEVLIYQGE RYKEYRGMGS IAAMKQRGYS RDRYGQADIG NVSKLVPEGI       420
     EARVPYKGPL SNLVYQLVGG LRSAMGYCGA RNIREMKENT KFMRITNAGL RESHPHDVVI       480
     TREAPNYRLR                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page