(data stored in ACNUC7421 zone)

EMBL: CP001825.PE499

CP001825.PE499       Location/Qualifiers
FT   CDS             560433..562214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0502"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   dps:DP2915 glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41423"
FT                   /db_xref="GOA:D1CER7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER7"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACZ41423.1"
FT                   /translation="MCGIFGYVGKDRDVAGLVLDGLKRLEYRGYDSWGVAVVTDEGINL
FT                   TKQVGKIGDAQVNMPDSFLGFGHTRWATHGGVTDYNAHPHLDCTGRIAVIHNGIIENFS
FT                   ELRNKLLSQGHKLRSETDTEVVAHLLEEETKGLGSDPAGFADALRRVFMQLEGMNAVMA
FT                   LDSSSGVMVAAKNGSPLVLGYGEDGYYISSDASALLPHTRKVAFIADGQMLLITREGVS
FT                   ARDIQTGDPASLEVSQLEWSLEQAELGDYPHYLIKEIHEQPSILRSIAMTQGENATTLA
FT                   EMMRASYGTFFIGCGTAANAALTGQYLFSRIARFHVNFAVGSEFGYLEHFLTPQSLVIA
FT                   LSQSGETIDVIEPLIKAKKEKGVQVAALVNVLGSTLYRMADFSVLLGAGPEKCVLATKS
FT                   YTAKLAVLLMTAYALDGRLDEGKELVLRAADGVEELLRDGIRDKVEALAERIYDREHIF
FT                   LIGRGLSYSSALEAALKIKEVTYIHAEGFAGGELKHGVIALIEQGTPCIVFAPSDETQA
FT                   AILSGAQELKARGGFIIGISPKCSDVFDYWIPVADVGDASPIVNAVPAQLLAYCLSIKR
FT                   GTDPDKPRNLAKSVTVK"
     MCGIFGYVGK DRDVAGLVLD GLKRLEYRGY DSWGVAVVTD EGINLTKQVG KIGDAQVNMP        60
     DSFLGFGHTR WATHGGVTDY NAHPHLDCTG RIAVIHNGII ENFSELRNKL LSQGHKLRSE       120
     TDTEVVAHLL EEETKGLGSD PAGFADALRR VFMQLEGMNA VMALDSSSGV MVAAKNGSPL       180
     VLGYGEDGYY ISSDASALLP HTRKVAFIAD GQMLLITREG VSARDIQTGD PASLEVSQLE       240
     WSLEQAELGD YPHYLIKEIH EQPSILRSIA MTQGENATTL AEMMRASYGT FFIGCGTAAN       300
     AALTGQYLFS RIARFHVNFA VGSEFGYLEH FLTPQSLVIA LSQSGETIDV IEPLIKAKKE       360
     KGVQVAALVN VLGSTLYRMA DFSVLLGAGP EKCVLATKSY TAKLAVLLMT AYALDGRLDE       420
     GKELVLRAAD GVEELLRDGI RDKVEALAER IYDREHIFLI GRGLSYSSAL EAALKIKEVT       480
     YIHAEGFAGG ELKHGVIALI EQGTPCIVFA PSDETQAAIL SGAQELKARG GFIIGISPKC       540
     SDVFDYWIPV ADVGDASPIV NAVPAQLLAY CLSIKRGTDP DKPRNLAKSV TVK              593
//

If you have problems or comments...

PBIL Back to PBIL home page