(data stored in ACNUC7421 zone)

EMBL: CP001825.PE5

CP001825.PE5         Location/Qualifiers
FT   CDS             3916..4698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0005"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bha:BH3101 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40929"
FT                   /db_xref="GOA:D1CDC3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACZ40929.1"
FT                   /translation="MEADTERFLQLQHMGNTLLITLNRPPVNAINLQVIEQLEEALTSY
FT                   EEDKNTKAVIITGNGRCFSAGADIKSFLEQDPDSPEIPLIRKANDVLNFIESYPKVVIA
FT                   AINGICLGGGNELALACDLRIASQNAIFGQPEIKLGLLPGWGGIQRLTRLLGKARALEM
FT                   CLTGESLNADRALQIGLVNEVVSPEGLIDRSLEISQKLSSLPTLAVNLIKQRIHKGAGA
FT                   SQGQAIREDEWAFRELLSSSYGQEGIKAFLEKREPRWD"
     MEADTERFLQ LQHMGNTLLI TLNRPPVNAI NLQVIEQLEE ALTSYEEDKN TKAVIITGNG        60
     RCFSAGADIK SFLEQDPDSP EIPLIRKAND VLNFIESYPK VVIAAINGIC LGGGNELALA       120
     CDLRIASQNA IFGQPEIKLG LLPGWGGIQR LTRLLGKARA LEMCLTGESL NADRALQIGL       180
     VNEVVSPEGL IDRSLEISQK LSSLPTLAVN LIKQRIHKGA GASQGQAIRE DEWAFRELLS       240
     SSYGQEGIKA FLEKREPRWD                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page