(data stored in ACNUC7421 zone)

EMBL: CP001825.PE50

CP001825.PE50        Location/Qualifiers
FT   CDS             52894..54816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0051"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40974"
FT                   /db_xref="GOA:D1CDG8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACZ40974.1"
FT                   /translation="MAQLEEKVISNYNAESIQVLEGLEAVRKRPGMYIGSTDVRGLHHL
FT                   IYEIVDNSVDESMAGYCDFIEVHIHKDKSVTVRDNGRGIPVGIHPKLKKSALEVVMTVL
FT                   HAGGKFGSGGYKVSGGLHGVGASVVNALSEYLIAEVHREGKIWRQSYERGVPKTPVEAI
FT                   GDTDRTGTIITFKPDADLFSTLEYQFDTLAQRFREIAYLNKGLKITFIDDRDDKELTLY
FT                   FEGGIASFVRHLNKNRNVLTEKPIYIHKQLNGIDVEVAIQYTDGFNESLHTFTNNINTV
FT                   DGGTHLTGFRTALTRTLNDYAVKNGLLKDSDTKLTGEDVREGLTAVVSVKLPDPQFEGQ
FT                   TKSKLGSSEAERVVASVVRDGLLSYFDENPSDAKRIIEKAITAARAREAARKARDLVVR
FT                   KGALDGMTLPGKLADCSERDPRHSELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNV
FT                   EKARLDKMLSSAEIKALITALGTGIGDSFDISKLRYHRIFLMTDADVDGAHIRTLLLTF
FT                   FFRHMPDIIKNGHLYIAMPPLYKIQVGKEKYFVYSDEERDRVLAGLNGNRSKAIIQRYK
FT                   GLGEMNPEQLWETTMDPSTRTIMQVTIEDAVKADELFDMLMGSNVAPRKKFIQSHAKSV
FT                   RNLDI"
     MAQLEEKVIS NYNAESIQVL EGLEAVRKRP GMYIGSTDVR GLHHLIYEIV DNSVDESMAG        60
     YCDFIEVHIH KDKSVTVRDN GRGIPVGIHP KLKKSALEVV MTVLHAGGKF GSGGYKVSGG       120
     LHGVGASVVN ALSEYLIAEV HREGKIWRQS YERGVPKTPV EAIGDTDRTG TIITFKPDAD       180
     LFSTLEYQFD TLAQRFREIA YLNKGLKITF IDDRDDKELT LYFEGGIASF VRHLNKNRNV       240
     LTEKPIYIHK QLNGIDVEVA IQYTDGFNES LHTFTNNINT VDGGTHLTGF RTALTRTLND       300
     YAVKNGLLKD SDTKLTGEDV REGLTAVVSV KLPDPQFEGQ TKSKLGSSEA ERVVASVVRD       360
     GLLSYFDENP SDAKRIIEKA ITAARAREAA RKARDLVVRK GALDGMTLPG KLADCSERDP       420
     RHSELYIVEG DSAGGSAKQG RDRRFQAILP LRGKILNVEK ARLDKMLSSA EIKALITALG       480
     TGIGDSFDIS KLRYHRIFLM TDADVDGAHI RTLLLTFFFR HMPDIIKNGH LYIAMPPLYK       540
     IQVGKEKYFV YSDEERDRVL AGLNGNRSKA IIQRYKGLGE MNPEQLWETT MDPSTRTIMQ       600
     VTIEDAVKAD ELFDMLMGSN VAPRKKFIQS HAKSVRNLDI                             640
//

If you have problems or comments...

PBIL Back to PBIL home page