(data stored in ACNUC7421 zone)

EMBL: CP001825.PE500

CP001825.PE500       Location/Qualifiers
FT   CDS             562211..562939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0503"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   putative RNA methylase; KEGG: bcy:Bcer98_1236
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41424"
FT                   /db_xref="GOA:D1CER8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER8"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACZ41424.1"
FT                   /translation="MKTRYLPPPEQKAQYVREMFTSIAPVYDRLNSIISLGLHRLWRRT
FT                   AVRLSGLKPGDSALDVATGTGDFAITLAKAVGPTGRVVGIDFSEGMLRLAHEKIKRLGL
FT                   DGVIQFEWADALSLPFADGEFDAATVGFAGRNVTDLKGMFSEMRRVVRPGGRVVHLELS
FT                   RPTLPIFRDIYRIYFYHLVPVVGGALARSRSAYGYLPESLSVFPSPEEVARVMREAGLV
FT                   KVRYYPLALGTVTVHVGVVP"
     MKTRYLPPPE QKAQYVREMF TSIAPVYDRL NSIISLGLHR LWRRTAVRLS GLKPGDSALD        60
     VATGTGDFAI TLAKAVGPTG RVVGIDFSEG MLRLAHEKIK RLGLDGVIQF EWADALSLPF       120
     ADGEFDAATV GFAGRNVTDL KGMFSEMRRV VRPGGRVVHL ELSRPTLPIF RDIYRIYFYH       180
     LVPVVGGALA RSRSAYGYLP ESLSVFPSPE EVARVMREAG LVKVRYYPLA LGTVTVHVGV       240
     VP                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page