(data stored in ACNUC7421 zone)

EMBL: CP001825.PE501

CP001825.PE501       Location/Qualifiers
FT   CDS             562936..563637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0504"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH01980 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41425"
FT                   /db_xref="GOA:D1CER9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER9"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACZ41425.1"
FT                   /translation="MSHAEDLRVVLFDALGTLIEITSPVDVFQRVMADMGYDLTREQIR
FT                   AAIRRAHQWWMSPTRVPGSTSEAERADRQKYAAMFLEDLGIDHDSSLVDEVAERGNWAR
FT                   WVSVYPDVIPALEALGRDYTLVVVTNGGPSMCDAINYAGLGRYFQEVFASWSVGYQKPD
FT                   PRAYNVPLARLRYRPSQACFIDDTPENVAGALDCGIRAVLLDRKGEHQGWTGERVSSLV
FT                   EFASLLAKREV"
     MSHAEDLRVV LFDALGTLIE ITSPVDVFQR VMADMGYDLT REQIRAAIRR AHQWWMSPTR        60
     VPGSTSEAER ADRQKYAAMF LEDLGIDHDS SLVDEVAERG NWARWVSVYP DVIPALEALG       120
     RDYTLVVVTN GGPSMCDAIN YAGLGRYFQE VFASWSVGYQ KPDPRAYNVP LARLRYRPSQ       180
     ACFIDDTPEN VAGALDCGIR AVLLDRKGEH QGWTGERVSS LVEFASLLAK REV              233
//

If you have problems or comments...

PBIL Back to PBIL home page