(data stored in ACNUC7421 zone)

EMBL: CP001825.PE504

CP001825.PE504       Location/Qualifiers
FT   CDS             complement(565064..565993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0507"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1865 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41428"
FT                   /db_xref="GOA:D1CES2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41428.1"
FT                   /translation="MRSVQAQRRYKKEEAITALLFISPWIIGFLVFTAGPMLASIYFSL
FT                   TEYNVLQPPEWVGLANYKEILTNDPLFWKSLYNTVYYTALYVPLHLAVALGLALLLNLN
FT                   VRGVPFWRTFFYLPSITPVVAVAILWRWILNPNSGILNRFLASVGLPTPGWTTDPNWMK
FT                   PALVLMSLWGAGGAMLIYLAGLKNIPRELYEAAQIDGAGRWARFLHITLPMISGVMFFN
FT                   LVISIIASLQTFAQPVLLFNTSEGGGSTTNDAVLLYIVYLFRQAFRYFHMGYASALAWI
FT                   IFVIIVIFTIIQFRLSQRWVYYEGGEQK"
     MRSVQAQRRY KKEEAITALL FISPWIIGFL VFTAGPMLAS IYFSLTEYNV LQPPEWVGLA        60
     NYKEILTNDP LFWKSLYNTV YYTALYVPLH LAVALGLALL LNLNVRGVPF WRTFFYLPSI       120
     TPVVAVAILW RWILNPNSGI LNRFLASVGL PTPGWTTDPN WMKPALVLMS LWGAGGAMLI       180
     YLAGLKNIPR ELYEAAQIDG AGRWARFLHI TLPMISGVMF FNLVISIIAS LQTFAQPVLL       240
     FNTSEGGGST TNDAVLLYIV YLFRQAFRYF HMGYASALAW IIFVIIVIFT IIQFRLSQRW       300
     VYYEGGEQK                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page