(data stored in ACNUC7421 zone)

EMBL: CP001825.PE51

CP001825.PE51        Location/Qualifiers
FT   CDS             54946..55962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0052"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG: fatty
FT                   acid/phospholipid synthesis protein PlsX; K03621 fatty
FT                   acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40975"
FT                   /db_xref="GOA:D1CDG9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG9"
FT                   /inference="protein motif:TFAM:TIGR00182"
FT                   /protein_id="ACZ40975.1"
FT                   /translation="MRVAVDAMGGDKAPDEIVEGALRASNELGIDITLVGKEDVIAPLL
FT                   SSKPSQRHIEIIHTPEIIAMDEHPATAVRKKKDSSIVRGLELLKEGKADAFVSAGNSGA
FT                   VMAASLFVLGRCTGIDRPAIGTIIPGKEGPVLLIDAGANVDPEPVHLLQFAFMGSIYAR
FT                   EVMRIGNPKVGLLSNGEEETKGNKLTLQAHKLLKGSNLNFQGNVEGRDVTKGTVHVIVT
FT                   DGFTGNVVLKTVEGVAEDLVSIIREEITSGILNKVGALILQGAFRKVAQKLDYAEYGGA
FT                   PLLGVRGNVFIAHGRSNAKAIKNAIRLAHEAASHRIPKLISDNNIIVTGKEMFQQDL"
     MRVAVDAMGG DKAPDEIVEG ALRASNELGI DITLVGKEDV IAPLLSSKPS QRHIEIIHTP        60
     EIIAMDEHPA TAVRKKKDSS IVRGLELLKE GKADAFVSAG NSGAVMAASL FVLGRCTGID       120
     RPAIGTIIPG KEGPVLLIDA GANVDPEPVH LLQFAFMGSI YAREVMRIGN PKVGLLSNGE       180
     EETKGNKLTL QAHKLLKGSN LNFQGNVEGR DVTKGTVHVI VTDGFTGNVV LKTVEGVAED       240
     LVSIIREEIT SGILNKVGAL ILQGAFRKVA QKLDYAEYGG APLLGVRGNV FIAHGRSNAK       300
     AIKNAIRLAH EAASHRIPKL ISDNNIIVTG KEMFQQDL                               338
//

If you have problems or comments...

PBIL Back to PBIL home page