(data stored in ACNUC7421 zone)

EMBL: CP001825.PE513

CP001825.PE513       Location/Qualifiers
FT   CDS             574350..577754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41437"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41437.1"
FT                   /translation="MMRDKCLSCRRVLRGVYHHSHLKRVHLLWLPALLLAVLLVFGVRS
FT                   SASAAGDSQSQAAATAQRLISKISDRVGGASVGTPQLVYNPDGRTPAYYVVPIVRSGDV
FT                   VGLIGVSPDGGKWQWYTTNYAPTGFPQTSRSRAASMLGTSAASLKLVAGRDNRLYWQSP
FT                   DGRALDVDRPSRQGTSVTLQAQGAGATYDARPGKYSELEVQKAKRRATLSPQSTEADTG
FT                   SGTLPTRYNLDVPHYYQENNYYCGPASLEMIFDLYGPDISQYDIADAMPAKDWGSWSGA
FT                   FSDDLVRAARFSYISKAVLDPNLQGYKQRRLGYAAIQYFWSYYGTSDPDYPNRYRDLKR
FT                   LIVAGYPVVVLTWYDSRHITGHFRVVKGYDDSTDEFIVHDPWYTAPYYGPDVHFNQEFF
FT                   VDNLWTKFKRWAALITPWQVSVSAPRTVQGGSTFKVTATITYPAITPLTGWAQVSNSVA
FT                   TILLPSGFTTDDATQGLPQVTYSGTSQTVTWTVTAPEDFEGQANIRVTAKGLISSSSTS
FT                   YPSYSDWIGGMGGDTIYVNQPPASVSVSPSSLRSGPNQYQTIQATYSDPGGAGTISRAM
FT                   IRVSDPDNPSNDLLAAYDTATGKIYLLSPDGSSTLSTASAGSSYTLQSSYGSVDPSKTT
FT                   VSTSGNQMVITWAVSRPTSASGSTNVVYLQAKDKYGASSGWQKEGSWVLNSPATADAVA
FT                   DSGAVVSPGRTVQIRATYSDPDGASNIRTAQLLINTQLTGSGSVWVRYDTAQNAMYIRS
FT                   GDNTYWAGPVTPGSSQSQSNGRATLLGASSAVSRSGNTLYITWGLNFDQSFSGRQYSIY
FT                   SVAADNYTPDSALPWLKFGTYTVDAPPAVGNVTPGSGISSPGRKVYYTASYSDPDGASN
FT                   IADARLLIGTSTSDTRAVQLRYDANGNKLYLKDDNSSAWLGGVSPGSSSSVSNGLATLF
FT                   PNLTTISRSGNTLTIKWAISYGTALSGRQYNTYLMVRDDFARAQSWQREGTWIVDRSPY
FT                   VGTTSPRNSGTSNRSWVAFKTTWYDPDGASNIRRVTFYINSSPSGYKGLMAKYEANSNK
FT                   LWLKSADNSTWLGGVAPGAPDRIRNGYVSIDPPRIKVSSSGTQMTITWYVFFTRQIAGR
FT                   NMNIYMSIVDDFGRAQSPVKIGTWYVR"
     MMRDKCLSCR RVLRGVYHHS HLKRVHLLWL PALLLAVLLV FGVRSSASAA GDSQSQAAAT        60
     AQRLISKISD RVGGASVGTP QLVYNPDGRT PAYYVVPIVR SGDVVGLIGV SPDGGKWQWY       120
     TTNYAPTGFP QTSRSRAASM LGTSAASLKL VAGRDNRLYW QSPDGRALDV DRPSRQGTSV       180
     TLQAQGAGAT YDARPGKYSE LEVQKAKRRA TLSPQSTEAD TGSGTLPTRY NLDVPHYYQE       240
     NNYYCGPASL EMIFDLYGPD ISQYDIADAM PAKDWGSWSG AFSDDLVRAA RFSYISKAVL       300
     DPNLQGYKQR RLGYAAIQYF WSYYGTSDPD YPNRYRDLKR LIVAGYPVVV LTWYDSRHIT       360
     GHFRVVKGYD DSTDEFIVHD PWYTAPYYGP DVHFNQEFFV DNLWTKFKRW AALITPWQVS       420
     VSAPRTVQGG STFKVTATIT YPAITPLTGW AQVSNSVATI LLPSGFTTDD ATQGLPQVTY       480
     SGTSQTVTWT VTAPEDFEGQ ANIRVTAKGL ISSSSTSYPS YSDWIGGMGG DTIYVNQPPA       540
     SVSVSPSSLR SGPNQYQTIQ ATYSDPGGAG TISRAMIRVS DPDNPSNDLL AAYDTATGKI       600
     YLLSPDGSST LSTASAGSSY TLQSSYGSVD PSKTTVSTSG NQMVITWAVS RPTSASGSTN       660
     VVYLQAKDKY GASSGWQKEG SWVLNSPATA DAVADSGAVV SPGRTVQIRA TYSDPDGASN       720
     IRTAQLLINT QLTGSGSVWV RYDTAQNAMY IRSGDNTYWA GPVTPGSSQS QSNGRATLLG       780
     ASSAVSRSGN TLYITWGLNF DQSFSGRQYS IYSVAADNYT PDSALPWLKF GTYTVDAPPA       840
     VGNVTPGSGI SSPGRKVYYT ASYSDPDGAS NIADARLLIG TSTSDTRAVQ LRYDANGNKL       900
     YLKDDNSSAW LGGVSPGSSS SVSNGLATLF PNLTTISRSG NTLTIKWAIS YGTALSGRQY       960
     NTYLMVRDDF ARAQSWQREG TWIVDRSPYV GTTSPRNSGT SNRSWVAFKT TWYDPDGASN      1020
     IRRVTFYINS SPSGYKGLMA KYEANSNKLW LKSADNSTWL GGVAPGAPDR IRNGYVSIDP      1080
     PRIKVSSSGT QMTITWYVFF TRQIAGRNMN IYMSIVDDFG RAQSPVKIGT WYVR            1134
//

If you have problems or comments...

PBIL Back to PBIL home page