(data stored in ACNUC7421 zone)

EMBL: CP001825.PE521

CP001825.PE521       Location/Qualifiers
FT   CDS             complement(583404..583964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41445"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41445.1"
FT                   /translation="MQGHKPLFPISRFLSNREFGNFSPSPWRSAPAPPPPSGGLPQAGC
FT                   LSWRVVSPPHSPVDLPPRSGEGVFVLWRGDLSRPLPWGTPGLGVWGIHGADSPHRSLCW
FT                   ITQGLGVLGIHERGLSTPLLCGSPRAGCVRDSWRGGGRESPPLLSMASPPPTKLHHSAI
FT                   QGGRGEHMSALRCPALSQGPPLP"
     MQGHKPLFPI SRFLSNREFG NFSPSPWRSA PAPPPPSGGL PQAGCLSWRV VSPPHSPVDL        60
     PPRSGEGVFV LWRGDLSRPL PWGTPGLGVW GIHGADSPHR SLCWITQGLG VLGIHERGLS       120
     TPLLCGSPRA GCVRDSWRGG GRESPPLLSM ASPPPTKLHH SAIQGGRGEH MSALRCPALS       180
     QGPPLP                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page