(data stored in ACNUC7421 zone)

EMBL: CP001825.PE523

CP001825.PE523       Location/Qualifiers
FT   CDS             complement(586956..589022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02389 dolichyl-phosphate-mannose--
FT                   protein mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41447"
FT                   /db_xref="GOA:D1CEU1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41447.1"
FT                   /translation="MPNTSLKKLAYRALPLAIILGASILPLYWFSKYMIIRPDSAWYLL
FT                   QGFNLLSGRGYTVFDQLPMPLRGPVLPFVVGTLSMLLGNDPMQVAWGMKLLSLANPLII
FT                   FLITSRLSGYWAGCLAALLWSFLGISGHLEHAFTVDSLLLTFVLLQLAIILSDVESPRA
FT                   WKPIVSGLLLALAVLTKETAMVLLPVGIIYCLLMCRGFRWLVLHYAAAAIACAPWWVWV
FT                   WLKVREIYLFSSTQETLLRFRLQEWIVYIPLLLVACILVAVVLSRRGLRLKATWYDLSG
FT                   YRLAGYRQGAAGVVNGCWVLAVSWMLLRGAEGEVYNTSTWSYIWDVLRPEFHLWILVPL
FT                   AYVFALRQSFAKKPSWVVYTHYMFLWTPLALLLMVIKLAPRQWLVYQALVYIAIAAVIF
FT                   TLARRAITLLRDNNQFVGKVAGALSLAMLVALLTLTGTSQVRALTSPPEGYNIWETNVQ
FT                   AEMALYRWLSNNVPEGESLVIATHDRKASHQLNLTAFLTARDYRWVPLQIRRVKIGKLL
FT                   NRSYSRLTTPVWLDSQYYCSFRYLSVAAVLRQMSAADAEYIVVPLRANSYPGNNALVRS
FT                   MLRTGLFDLSYYRTVTLYSPEEHKDIQLTHVVLRRNGLKLGKATEVPTILDSSTLERLG
FT                   ECAAESAGDNSELAIVLALPNGMTLQQFTPEGKAEYQEIWRWAYSSTTPQPGR"
     MPNTSLKKLA YRALPLAIIL GASILPLYWF SKYMIIRPDS AWYLLQGFNL LSGRGYTVFD        60
     QLPMPLRGPV LPFVVGTLSM LLGNDPMQVA WGMKLLSLAN PLIIFLITSR LSGYWAGCLA       120
     ALLWSFLGIS GHLEHAFTVD SLLLTFVLLQ LAIILSDVES PRAWKPIVSG LLLALAVLTK       180
     ETAMVLLPVG IIYCLLMCRG FRWLVLHYAA AAIACAPWWV WVWLKVREIY LFSSTQETLL       240
     RFRLQEWIVY IPLLLVACIL VAVVLSRRGL RLKATWYDLS GYRLAGYRQG AAGVVNGCWV       300
     LAVSWMLLRG AEGEVYNTST WSYIWDVLRP EFHLWILVPL AYVFALRQSF AKKPSWVVYT       360
     HYMFLWTPLA LLLMVIKLAP RQWLVYQALV YIAIAAVIFT LARRAITLLR DNNQFVGKVA       420
     GALSLAMLVA LLTLTGTSQV RALTSPPEGY NIWETNVQAE MALYRWLSNN VPEGESLVIA       480
     THDRKASHQL NLTAFLTARD YRWVPLQIRR VKIGKLLNRS YSRLTTPVWL DSQYYCSFRY       540
     LSVAAVLRQM SAADAEYIVV PLRANSYPGN NALVRSMLRT GLFDLSYYRT VTLYSPEEHK       600
     DIQLTHVVLR RNGLKLGKAT EVPTILDSST LERLGECAAE SAGDNSELAI VLALPNGMTL       660
     QQFTPEGKAE YQEIWRWAYS STTPQPGR                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page