(data stored in ACNUC7421 zone)

EMBL: CP001825.PE524

CP001825.PE524       Location/Qualifiers
FT   CDS             589102..589755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0530"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: hch:HCH_02655
FT                   ATP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41448"
FT                   /db_xref="GOA:D1CEU2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ41448.1"
FT                   /translation="MTSNGIRTLDLALLITYILLTGLVAVTLAPLSSFWWIFPLCATAL
FT                   LLAILLGARGRSTGKDPVTMARIVRILHQSSTITPAQLASSTGMSLKDSRSVLESLVGE
FT                   GVLARSETDSDLYLRAYYPAAETLENRVKPQYLPEAPPAAGQTQNQDLLEPLSERELEI
FT                   LSLMASGHTNSEIARELYVAVGTVKSHVNNIYRKLGAKNRVEALSRARELGLIR"
     MTSNGIRTLD LALLITYILL TGLVAVTLAP LSSFWWIFPL CATALLLAIL LGARGRSTGK        60
     DPVTMARIVR ILHQSSTITP AQLASSTGMS LKDSRSVLES LVGEGVLARS ETDSDLYLRA       120
     YYPAAETLEN RVKPQYLPEA PPAAGQTQNQ DLLEPLSERE LEILSLMASG HTNSEIAREL       180
     YVAVGTVKSH VNNIYRKLGA KNRVEALSRA RELGLIR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page