(data stored in ACNUC7421 zone)

EMBL: CP001825.PE525

CP001825.PE525       Location/Qualifiers
FT   CDS             589922..590296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41449"
FT                   /db_xref="GOA:D1CEU3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41449.1"
FT                   /translation="MSRVSAVLYSILISLFTLFVLLQVFFAGLAVFYTPVYWTWHITLV
FT                   HVFEWIPLFLIVFSLLGRMSAWARLSSIGLFLLLIVQYATANIREVPFISALHPVNALM
FT                   IFLIAILATYSSWREVLGGD"
     MSRVSAVLYS ILISLFTLFV LLQVFFAGLA VFYTPVYWTW HITLVHVFEW IPLFLIVFSL        60
     LGRMSAWARL SSIGLFLLLI VQYATANIRE VPFISALHPV NALMIFLIAI LATYSSWREV       120
     LGGD                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page