(data stored in ACNUC7421 zone)

EMBL: CP001825.PE529

CP001825.PE529       Location/Qualifiers
FT   CDS             593691..594362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0535"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: sus:Acid_1354 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41453"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU7"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACZ41453.1"
FT                   /translation="MKRLVALLSVVMLLIAAVAYSYLKPTAAPSGPITADPVSTPSGDT
FT                   DARVFTISQDGSQARFIIDEVLNGSPKTVVGTTNQVAGQISIDPNDVSSTRVGTIRINA
FT                   RTFQTDSSQRDRAIQNRILETSSYEFITFTPREITGLPGDPAIGRTYNLKVTGDLKIKD
FT                   VSREVTFDVTVKPESQSRLTGKATATIKYADWGISIPQVPFVANVSDEVRLELDFLAVS
FT                   S"
     MKRLVALLSV VMLLIAAVAY SYLKPTAAPS GPITADPVST PSGDTDARVF TISQDGSQAR        60
     FIIDEVLNGS PKTVVGTTNQ VAGQISIDPN DVSSTRVGTI RINARTFQTD SSQRDRAIQN       120
     RILETSSYEF ITFTPREITG LPGDPAIGRT YNLKVTGDLK IKDVSREVTF DVTVKPESQS       180
     RLTGKATATI KYADWGISIP QVPFVANVSD EVRLELDFLA VSS                         223
//

If you have problems or comments...

PBIL Back to PBIL home page