(data stored in ACNUC7421 zone)

EMBL: CP001825.PE530

CP001825.PE530       Location/Qualifiers
FT   CDS             complement(594422..596848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0536"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: afw:Anae109_2098 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41454"
FT                   /db_xref="GOA:D1CEU8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU8"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACZ41454.1"
FT                   /translation="MNNQEQPEANIPSLLPVLPLRDSVIYPFAVLPIVVGQERSIRLVD
FT                   DSMRSRRLIVLVAQRSRNVEQAGPDDIYRIGTVATIHHLVRAPDGTLRIVVQGVQRVRI
FT                   LDFISTQPYLVARIDPAPDQTENNVEEEALRRVAVDLFRRMVEISPDLPNEILPTLDSI
FT                   QDPIQTFYFIAGAIQLDVDTRQELLELEPLEVKLRRLVEILQKELSIREISQRIQSETQ
FT                   ERLTQAQREAYLREQLRTIQSQLGEGPEQSEVNELRRRIEEAGLPEEARKEAERELNRL
FT                   STIPMASPEYAIIRTYLEWLADLPWNKLSGGTIDTQRAREILDEDHYDLEKVKDRIIEH
FT                   LAVRKLREQRVSNLSGQEGTGEQNTIPSGSGDTLREPILCFVGPPGVGKTSLGQSIARA
FT                   LGRKFIRMSLGGIRDEAEIRGHRRTYIGAMPGRIIQGMRRVGTKDPVFMLDEIDKITVG
FT                   FQGDPAAALLEVLDPAQNHSFVDNYLGVPFDLSQVLFIATANTLDTIPAPLLDRMEVIQ
FT                   ISGYTEQEKLFIAQRYLIPKQMRAHGIQDSELRFTEESIRKIIREYTQEAGVRNLDRQI
FT                   ATICRKVARAIADGAAQSIEITPDNLQEYLGHPRHFHSTAERITRPGVATGLAWTPTGG
FT                   EILFIEATMMPDPHPRVILTGMLGEVMRESAQIALSYVRSEADPLGVNPDAFTGKTVHI
FT                   HVPAGAIPKDGPSAGLAIVAALASLGSSRLVRSDVAMTGEITLRGKVLPVGGIKEKVLA
FT                   AHRAGIKTVILPKENEQDLEDIPQELRDQMRFVLVDNIEDAMQVALTELPVLEET"
     MNNQEQPEAN IPSLLPVLPL RDSVIYPFAV LPIVVGQERS IRLVDDSMRS RRLIVLVAQR        60
     SRNVEQAGPD DIYRIGTVAT IHHLVRAPDG TLRIVVQGVQ RVRILDFIST QPYLVARIDP       120
     APDQTENNVE EEALRRVAVD LFRRMVEISP DLPNEILPTL DSIQDPIQTF YFIAGAIQLD       180
     VDTRQELLEL EPLEVKLRRL VEILQKELSI REISQRIQSE TQERLTQAQR EAYLREQLRT       240
     IQSQLGEGPE QSEVNELRRR IEEAGLPEEA RKEAERELNR LSTIPMASPE YAIIRTYLEW       300
     LADLPWNKLS GGTIDTQRAR EILDEDHYDL EKVKDRIIEH LAVRKLREQR VSNLSGQEGT       360
     GEQNTIPSGS GDTLREPILC FVGPPGVGKT SLGQSIARAL GRKFIRMSLG GIRDEAEIRG       420
     HRRTYIGAMP GRIIQGMRRV GTKDPVFMLD EIDKITVGFQ GDPAAALLEV LDPAQNHSFV       480
     DNYLGVPFDL SQVLFIATAN TLDTIPAPLL DRMEVIQISG YTEQEKLFIA QRYLIPKQMR       540
     AHGIQDSELR FTEESIRKII REYTQEAGVR NLDRQIATIC RKVARAIADG AAQSIEITPD       600
     NLQEYLGHPR HFHSTAERIT RPGVATGLAW TPTGGEILFI EATMMPDPHP RVILTGMLGE       660
     VMRESAQIAL SYVRSEADPL GVNPDAFTGK TVHIHVPAGA IPKDGPSAGL AIVAALASLG       720
     SSRLVRSDVA MTGEITLRGK VLPVGGIKEK VLAAHRAGIK TVILPKENEQ DLEDIPQELR       780
     DQMRFVLVDN IEDAMQVALT ELPVLEET                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page