(data stored in ACNUC7421 zone)

EMBL: CP001825.PE533

CP001825.PE533       Location/Qualifiers
FT   CDS             complement(598176..598661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0539"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   aba:Acid345_4766 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41457"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV1"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41457.1"
FT                   /translation="MSIQRWDPFREMMSLRDAVNRLLEESFVSPSLLMGTRESSFPVDI
FT                   EETDDNFVLRASLPGYKPEEINVSITGDTLTISAEHKEEGERREGSYLVRERRLGKVTR
FT                   TFTLPTRISGDQASAKYENGELVLTLPKAEESKPRRIQITTGAQTSQPSIEPQSTTQ"
     MSIQRWDPFR EMMSLRDAVN RLLEESFVSP SLLMGTRESS FPVDIEETDD NFVLRASLPG        60
     YKPEEINVSI TGDTLTISAE HKEEGERREG SYLVRERRLG KVTRTFTLPT RISGDQASAK       120
     YENGELVLTL PKAEESKPRR IQITTGAQTS QPSIEPQSTT Q                           161
//

If you have problems or comments...

PBIL Back to PBIL home page