(data stored in ACNUC7421 zone)

EMBL: CP001825.PE534

CP001825.PE534       Location/Qualifiers
FT   CDS             598787..599710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0540"
FT                   /product="Ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mxa:MXAN_0663 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41458"
FT                   /db_xref="GOA:D1CEV2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV2"
FT                   /inference="protein motif:PRIAM:3.1.26.11"
FT                   /protein_id="ACZ41458.1"
FT                   /translation="MLDVTLLGTSGTLPLPGRYLSSALIRIGGKLFLIDCGEGTQVALR
FT                   AKGWGIRRIDSILLTHSHADHVLGLPGLLLTLAFSQRGAEEPLRIFGPPSVLPVLESIR
FT                   VFAPRLPYPVYFIPLEVGDEVDVTDNLKLFAGPTEHDVPCLSYSLYVPRSPKFDVERAN
FT                   SLGVPRDLWGRLQRGESVFVGEREIQPQDVLGPPRKGLKLVFITDTRFTEDLVSFASKI
FT                   QPPDLLISEGMYGDESMRPKDWDVPHMTFAEAAKVASASGARLLWLTHYSPMMADPSRY
FT                   IENARRIFPNAIAAQDGTEISLSYED"
     MLDVTLLGTS GTLPLPGRYL SSALIRIGGK LFLIDCGEGT QVALRAKGWG IRRIDSILLT        60
     HSHADHVLGL PGLLLTLAFS QRGAEEPLRI FGPPSVLPVL ESIRVFAPRL PYPVYFIPLE       120
     VGDEVDVTDN LKLFAGPTEH DVPCLSYSLY VPRSPKFDVE RANSLGVPRD LWGRLQRGES       180
     VFVGEREIQP QDVLGPPRKG LKLVFITDTR FTEDLVSFAS KIQPPDLLIS EGMYGDESMR       240
     PKDWDVPHMT FAEAAKVASA SGARLLWLTH YSPMMADPSR YIENARRIFP NAIAAQDGTE       300
     ISLSYED                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page