(data stored in ACNUC7421 zone)

EMBL: CP001825.PE536

CP001825.PE536       Location/Qualifiers
FT   CDS             600883..601635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0542"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: csa:Csal_0292 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41460"
FT                   /db_xref="GOA:D1CEV4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41460.1"
FT                   /translation="MLIGARQDCVLGDTLEDRMRILKALGYDFVELALTRSEIAGLDAH
FT                   SADYYKNIVESTGLPILSTSMGHFGHFASLNDEERAEIVSHVDKLITFTHDIGADAILL
FT                   ATQEESLKVSEYLSIYRQHILPLADKALDLGVTLALEHVNWYKPWALAELVKGLNHPAV
FT                   GIYFDMGNCLYVGENPKEQAKICAPYTAHLHIKGGPVAPLAAMPLEEIKSILEAGGFHG
FT                   RGCLEIMTVEGNRHLSEAMGLLRMAGYK"
     MLIGARQDCV LGDTLEDRMR ILKALGYDFV ELALTRSEIA GLDAHSADYY KNIVESTGLP        60
     ILSTSMGHFG HFASLNDEER AEIVSHVDKL ITFTHDIGAD AILLATQEES LKVSEYLSIY       120
     RQHILPLADK ALDLGVTLAL EHVNWYKPWA LAELVKGLNH PAVGIYFDMG NCLYVGENPK       180
     EQAKICAPYT AHLHIKGGPV APLAAMPLEE IKSILEAGGF HGRGCLEIMT VEGNRHLSEA       240
     MGLLRMAGYK                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page