(data stored in ACNUC7421 zone)

EMBL: CP001825.PE538

CP001825.PE538       Location/Qualifiers
FT   CDS             complement(602523..603167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41462"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41462.1"
FT                   /translation="MSRKIISWLVVPLLVILLAGGILVAAALRSSQVPTRPGGGPTSAH
FT                   SPLIGLLIPKTDRKFGYGMLVPARWQAVDLGDRRAYVPPDSQHKSDRLVLTATNYRVLA
FT                   DRNKNLRVMQLELFRQHPDPVGWTKAIEMSWRDTGMRFQKESGLANGVIYSVRPAEDQM
FT                   QLVAFLVDAGQPMNLTMEGYGTYSSRETLVREGLLEDFQTMAQSLHAVDTK"
     MSRKIISWLV VPLLVILLAG GILVAAALRS SQVPTRPGGG PTSAHSPLIG LLIPKTDRKF        60
     GYGMLVPARW QAVDLGDRRA YVPPDSQHKS DRLVLTATNY RVLADRNKNL RVMQLELFRQ       120
     HPDPVGWTKA IEMSWRDTGM RFQKESGLAN GVIYSVRPAE DQMQLVAFLV DAGQPMNLTM       180
     EGYGTYSSRE TLVREGLLED FQTMAQSLHA VDTK                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page