(data stored in ACNUC7421 zone)

EMBL: CP001825.PE542

CP001825.PE542       Location/Qualifiers
FT   CDS             complement(606428..606817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41466"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41466.1"
FT                   /translation="MSTEKVVEKLSKQVDRRRFLGIASKAALGFLLLLSSRRIQTAEAY
FT                   HTNCTNYNTVRTKYCCHLGYRDDCTSTESSNCFTYGTSHPSWWLWTCCYGTALVECREC
FT                   CKYSCSKAVLTPSCGSCGGTANVNC"
     MSTEKVVEKL SKQVDRRRFL GIASKAALGF LLLLSSRRIQ TAEAYHTNCT NYNTVRTKYC        60
     CHLGYRDDCT STESSNCFTY GTSHPSWWLW TCCYGTALVE CRECCKYSCS KAVLTPSCGS       120
     CGGTANVNC                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page