(data stored in ACNUC7421 zone)

EMBL: CP001825.PE545

CP001825.PE545       Location/Qualifiers
FT   CDS             complement(608190..609083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0551"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41469"
FT                   /db_xref="GOA:D1CEW3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW3"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ41469.1"
FT                   /translation="MEEESNRATSIDRQESEGFDLPQEPGPEVSPSGTTPLQPSEIIRL
FT                   PTRHNPTLQKLVGIVNSDEDLHAIWRCQNVNGVDRLGMSDHGPVHVQIVANLALRLLRL
FT                   LMAKNIQPSIVKDHGMSEHDAEVVVVLAALLHDCGMSIHRDDHEFMSLFIALPKLQELL
FT                   SNLYSAAERRVIISETLHAIITHRSDGRPLTLEAGIVRVADALDMAQGRSRIPFESGHV
FT                   NIHSVSAAAIEKVEINQGQEKAIRVTIYMSNAAGIFQIDELLRQKLKGSGLETHVEVVA
FT                   QVTGESDKRLVETFKF"
     MEEESNRATS IDRQESEGFD LPQEPGPEVS PSGTTPLQPS EIIRLPTRHN PTLQKLVGIV        60
     NSDEDLHAIW RCQNVNGVDR LGMSDHGPVH VQIVANLALR LLRLLMAKNI QPSIVKDHGM       120
     SEHDAEVVVV LAALLHDCGM SIHRDDHEFM SLFIALPKLQ ELLSNLYSAA ERRVIISETL       180
     HAIITHRSDG RPLTLEAGIV RVADALDMAQ GRSRIPFESG HVNIHSVSAA AIEKVEINQG       240
     QEKAIRVTIY MSNAAGIFQI DELLRQKLKG SGLETHVEVV AQVTGESDKR LVETFKF          297
//

If you have problems or comments...

PBIL Back to PBIL home page