(data stored in ACNUC7421 zone)

EMBL: CP001825.PE546

CP001825.PE546       Location/Qualifiers
FT   CDS             609226..610269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0552"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; KEGG: helix-turn-helix type 11
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41470"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW4"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACZ41470.1"
FT                   /translation="MSRLVKLGRLQRIERILYQNPQGLTIQRLAELCDVSIRTIYRDIK
FT                   DLEQIFEVPLTRENGRWKVVRTSYLPPVRFSLHEAMGLFLSYRLALRYMDKQNPDLEEA
FT                   WSKIGSVMPEPISRFFPETLREIKNKPLDREYNRTVRTLTSAWAEGRRVRIQYLSSRRS
FT                   TPKERLIEPYFMQPSGISHALYVIARDVEIDEIRTFKVQRIKDIELTDEKYEIPGDFDA
FT                   LEFLKNSWTIWSDEPVEVKVRFSPRVASAVKEAIWHPTQELKEEPDGSVIWTGRVSGIL
FT                   EISAWIRSWGAEAEVLEPKSLRESLVNDVQSLAKLYGLGLTESASKQEGQCTVEIQDTK
FT                   NFAHETS"
     MSRLVKLGRL QRIERILYQN PQGLTIQRLA ELCDVSIRTI YRDIKDLEQI FEVPLTRENG        60
     RWKVVRTSYL PPVRFSLHEA MGLFLSYRLA LRYMDKQNPD LEEAWSKIGS VMPEPISRFF       120
     PETLREIKNK PLDREYNRTV RTLTSAWAEG RRVRIQYLSS RRSTPKERLI EPYFMQPSGI       180
     SHALYVIARD VEIDEIRTFK VQRIKDIELT DEKYEIPGDF DALEFLKNSW TIWSDEPVEV       240
     KVRFSPRVAS AVKEAIWHPT QELKEEPDGS VIWTGRVSGI LEISAWIRSW GAEAEVLEPK       300
     SLRESLVNDV QSLAKLYGLG LTESASKQEG QCTVEIQDTK NFAHETS                     347
//

If you have problems or comments...

PBIL Back to PBIL home page