(data stored in ACNUC7421 zone)

EMBL: CP001825.PE547

CP001825.PE547       Location/Qualifiers
FT   CDS             610296..611714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0553"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: acp:A2cp1_0251 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41471"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW5"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_0251"
FT                   /protein_id="ACZ41471.1"
FT                   /translation="MVGSGPNGLAAAITLARRGLRVLLLEASDHLGGAAASLQLTLPGF
FT                   THDLGAAVLPLAFTSPFFLEMPLRDLGVEWVYPDVPLAHPLGPREVLLLHESIQETAIQ
FT                   FGDDGARYSRLISPLVSEWPGLARDLLAPAIKIPRTLSYIRFGVHALLPFSVLADALFS
FT                   TSHARTLLAGVAAHWAMPLTRPLTSVPILLLCTLAHITRWPMARGGTGRLIEAMAAYFR
FT                   DLGGVVQLSAPVHSLSDIPPAKAVLFDLAPRQVVDILGDRLPSGYRRACARYRHGPGVL
FT                   KLDWALSAPIPWISEACRSAGTVHLGGTFEEIADTERSVWEGHVPSRPFVILNQPSVFD
FT                   PGRCPGGYHTAWAYCHVPVSITNKEVEYLANRIESAIEELAPGFRDTILARSVLAPTDL
FT                   EYLDSNLVAGDLTGGVLDLWQVLARPVLSHVPYKIPVSGMYICSSSTPPGPGVHGMCGY
FT                   WAARSALRYTFHME"
     MVGSGPNGLA AAITLARRGL RVLLLEASDH LGGAAASLQL TLPGFTHDLG AAVLPLAFTS        60
     PFFLEMPLRD LGVEWVYPDV PLAHPLGPRE VLLLHESIQE TAIQFGDDGA RYSRLISPLV       120
     SEWPGLARDL LAPAIKIPRT LSYIRFGVHA LLPFSVLADA LFSTSHARTL LAGVAAHWAM       180
     PLTRPLTSVP ILLLCTLAHI TRWPMARGGT GRLIEAMAAY FRDLGGVVQL SAPVHSLSDI       240
     PPAKAVLFDL APRQVVDILG DRLPSGYRRA CARYRHGPGV LKLDWALSAP IPWISEACRS       300
     AGTVHLGGTF EEIADTERSV WEGHVPSRPF VILNQPSVFD PGRCPGGYHT AWAYCHVPVS       360
     ITNKEVEYLA NRIESAIEEL APGFRDTILA RSVLAPTDLE YLDSNLVAGD LTGGVLDLWQ       420
     VLARPVLSHV PYKIPVSGMY ICSSSTPPGP GVHGMCGYWA ARSALRYTFH ME               472
//

If you have problems or comments...

PBIL Back to PBIL home page