(data stored in ACNUC7421 zone)

EMBL: CP001825.PE549

CP001825.PE549       Location/Qualifiers
FT   CDS             complement(612901..613890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0555"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: gbm:Gbem_4017 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41473"
FT                   /db_xref="GOA:D1CEW7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW7"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ACZ41473.1"
FT                   /translation="MSELRWHPLLREWVITATHRQDRTFLPPRDYCPLCPTKSGKHETE
FT                   IPVETFDIAVFENKFPSLQRQPPQPAIEPMGIFDVRPAEGVCEVVVYTPEHDTTLTDQS
FT                   VSHIRRLIAVWRDRYIELGSLPYVKYVFIFENKGEVIGVTLHHPHGQIYAYPFIPPLMQ
FT                   RELSALSEHRAKTGRCLVCDVLQQETNYGKRILFEEGNFVAFIPFYARWPYEVHIIPRR
FT                   HFGSLAEITSEESWDLAYALKRVLVGYDKLFGFSMPFIMALHQTPTDDQEHPYYHFQLQ
FT                   FYPPHRTSTKLKYLAGSETGAGTFINDSLPEEKAPELRAVIPDKESIE"
     MSELRWHPLL REWVITATHR QDRTFLPPRD YCPLCPTKSG KHETEIPVET FDIAVFENKF        60
     PSLQRQPPQP AIEPMGIFDV RPAEGVCEVV VYTPEHDTTL TDQSVSHIRR LIAVWRDRYI       120
     ELGSLPYVKY VFIFENKGEV IGVTLHHPHG QIYAYPFIPP LMQRELSALS EHRAKTGRCL       180
     VCDVLQQETN YGKRILFEEG NFVAFIPFYA RWPYEVHIIP RRHFGSLAEI TSEESWDLAY       240
     ALKRVLVGYD KLFGFSMPFI MALHQTPTDD QEHPYYHFQL QFYPPHRTST KLKYLAGSET       300
     GAGTFINDSL PEEKAPELRA VIPDKESIE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page