(data stored in ACNUC7421 zone)

EMBL: CP001825.PE550

CP001825.PE550       Location/Qualifiers
FT   CDS             complement(613883..614056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41474"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41474.1"
FT                   /translation="MAADSQSWQPEMIKSKEQKKDGRYIIYYTFTEHTDQQQVPAHGQD
FT                   QAVTSSEGNKDV"
     MAADSQSWQP EMIKSKEQKK DGRYIIYYTF TEHTDQQQVP AHGQDQAVTS SEGNKDV           57
//

If you have problems or comments...

PBIL Back to PBIL home page