(data stored in ACNUC7421 zone)

EMBL: CP001825.PE554

CP001825.PE554       Location/Qualifiers
FT   CDS             complement(616503..618005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0560"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: aba:Acid345_1459
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41478"
FT                   /db_xref="GOA:D1CEX2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACZ41478.1"
FT                   /translation="MREYMNYIDGKWVPSSTGETFKSINPANGEVVAVLAKSSREDVDK
FT                   AVQAARRAFDKWRLYPAPRRGEILYEVGRILKERKEDLARLMTQEMGKVLTEARGDVQE
FT                   GIDMAFYVGGEGRRLFGVTTPSEMPNKFQMAVRDPVGVVAAITPWNFPIAIPTWKLMPA
FT                   LVAGNTVVFKPASDTPALGAELVKIFEEAGLPPGVLNLVTGTGEEVGKALLEHPGVDVI
FT                   SFTGSTDTGSQVLTQTASKNKKISLEMGGKNAITVMDDADIDLAIEGILWSAFGTTGQR
FT                   CTACSRLIVHKSIRDTLTEKLLSRIQNLRLGDGLDPETDVGPVINERQLNKIHQYVGIG
FT                   REEGAKLLIGGDRATDGELSKGFFYKPTLFTDVDPNMRIAQEEIFGPVLSMITVNSLEE
FT                   AIKVNNCTKYGLSSSIYTRDINKAFRAMRDFNTGIVYINHGTIGAEVHLPFGGTKGTGN
FT                   GHREGAVWAALDVFTEWKSVYIDFSGRLQRAQIDIDKINIES"
     MREYMNYIDG KWVPSSTGET FKSINPANGE VVAVLAKSSR EDVDKAVQAA RRAFDKWRLY        60
     PAPRRGEILY EVGRILKERK EDLARLMTQE MGKVLTEARG DVQEGIDMAF YVGGEGRRLF       120
     GVTTPSEMPN KFQMAVRDPV GVVAAITPWN FPIAIPTWKL MPALVAGNTV VFKPASDTPA       180
     LGAELVKIFE EAGLPPGVLN LVTGTGEEVG KALLEHPGVD VISFTGSTDT GSQVLTQTAS       240
     KNKKISLEMG GKNAITVMDD ADIDLAIEGI LWSAFGTTGQ RCTACSRLIV HKSIRDTLTE       300
     KLLSRIQNLR LGDGLDPETD VGPVINERQL NKIHQYVGIG REEGAKLLIG GDRATDGELS       360
     KGFFYKPTLF TDVDPNMRIA QEEIFGPVLS MITVNSLEEA IKVNNCTKYG LSSSIYTRDI       420
     NKAFRAMRDF NTGIVYINHG TIGAEVHLPF GGTKGTGNGH REGAVWAALD VFTEWKSVYI       480
     DFSGRLQRAQ IDIDKINIES                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page