(data stored in ACNUC7421 zone)

EMBL: CP001825.PE555

CP001825.PE555       Location/Qualifiers
FT   CDS             618130..618879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41479"
FT                   /db_xref="GOA:D1CEX3"
FT                   /db_xref="InterPro:IPR011578"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41479.1"
FT                   /translation="MRRRRKSRFANSMEERFAAILDLLRLRWQYEPHTFVLRRRFDGSP
FT                   MVAFTPDFYLEEFDLYVELTMHKRRLVTLKNRKVRLMREKYPEHNIRLLYLHDCLSLIR
FT                   PVRSYKEREKVLRRLIPWASQEHYDRVRWHRRLVRRVSSSGRVHFLGKVLSLGADWAGK
FT                   ECIIWVYSDHLDIEIEGRTIASLECAYDNRKDKLLQVQSKVLIDNEPLEGNLLPAGRRI
FT                   LSLVQEDTGNASHGLVRCYAQASFQLF"
     MRRRRKSRFA NSMEERFAAI LDLLRLRWQY EPHTFVLRRR FDGSPMVAFT PDFYLEEFDL        60
     YVELTMHKRR LVTLKNRKVR LMREKYPEHN IRLLYLHDCL SLIRPVRSYK EREKVLRRLI       120
     PWASQEHYDR VRWHRRLVRR VSSSGRVHFL GKVLSLGADW AGKECIIWVY SDHLDIEIEG       180
     RTIASLECAY DNRKDKLLQV QSKVLIDNEP LEGNLLPAGR RILSLVQEDT GNASHGLVRC       240
     YAQASFQLF                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page