(data stored in ACNUC7421 zone)

EMBL: CP001825.PE556

CP001825.PE556       Location/Qualifiers
FT   CDS             complement(619134..620036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0562"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   esa:ESA_03540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41480"
FT                   /db_xref="GOA:D1CEX4"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX4"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACZ41480.1"
FT                   /translation="MARINVKVPEIRWETQRVKIPEANGKLGLPQNIGKSLETMISRRS
FT                   QPPKVDNKSRLIFLGIGAVLGAIAGLLFAPRTGRATRSYILQKGQRYLRVTSRQANRTL
FT                   RYTSHMVTGKARALYYRVAQKTDYDLTPETIEHRVETRLGEDPVIGRLPRLNVNAEPGG
FT                   VVYLRGSVPRENLRHRAELIASRVRGVTEVINEISVVPEGEKLKETGNHDLGLMRQVIN
FT                   KILDDDKLKEHAIEVEAEVGGTVFLRGTVHTENERLRAEKLVKGMPGVKTVVNDLAVVS
FT                   PAKDIVEGYREKTPPQQTH"
     MARINVKVPE IRWETQRVKI PEANGKLGLP QNIGKSLETM ISRRSQPPKV DNKSRLIFLG        60
     IGAVLGAIAG LLFAPRTGRA TRSYILQKGQ RYLRVTSRQA NRTLRYTSHM VTGKARALYY       120
     RVAQKTDYDL TPETIEHRVE TRLGEDPVIG RLPRLNVNAE PGGVVYLRGS VPRENLRHRA       180
     ELIASRVRGV TEVINEISVV PEGEKLKETG NHDLGLMRQV INKILDDDKL KEHAIEVEAE       240
     VGGTVFLRGT VHTENERLRA EKLVKGMPGV KTVVNDLAVV SPAKDIVEGY REKTPPQQTH       300
//

If you have problems or comments...

PBIL Back to PBIL home page