(data stored in ACNUC7421 zone)

EMBL: CP001825.PE56

CP001825.PE56        Location/Qualifiers
FT   CDS             complement(59114..59530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0057"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: afr:AFE_0850
FT                   septum formation initiator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40980"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH4"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACZ40980.1"
FT                   /translation="MLNLDLIRDRRSQIARLVLLLCAAYFALAFVAQAWKARNLNQVLV
FT                   QERAKLEQQEARNRELQEQLEMLSGKEYSVYVERVAREKLGMVKPGDIPVFVVPNPQAP
FT                   KRQQKVLTAGEEQTGTNRQSDIPVWRQWISVLLK"
     MLNLDLIRDR RSQIARLVLL LCAAYFALAF VAQAWKARNL NQVLVQERAK LEQQEARNRE        60
     LQEQLEMLSG KEYSVYVERV AREKLGMVKP GDIPVFVVPN PQAPKRQQKV LTAGEEQTGT       120
     NRQSDIPVWR QWISVLLK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page