(data stored in ACNUC7421 zone)

EMBL: CP001825.PE560

CP001825.PE560       Location/Qualifiers
FT   CDS             complement(623709..624521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0566"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   dal:Dalk_3152 protein of unknown function DUF62"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41484"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX8"
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /protein_id="ACZ41484.1"
FT                   /translation="MSRLPNLVTFITDFGLDWGPVGICHAVMRGINPQISIVDISHGIP
FT                   AFDIRAGAWVLTSIFPYVPPAVHVVVVDPGVGTQRLPIAILCRRGDVLIGPDNGVLIPA
FT                   TRRLGGIVEARKISNKALMRPDISYTFHGRDIFCPVAAHLSSGVSFEDVGEILPISDLV
FT                   QAPWREPEIYEHRVVAEVAILDKFGNIRTNIEAADWPLSTGEKIILKHKNNQVNLAVAR
FT                   TFGEVNRGDLLIYEDSSRFICIGQNLGHAGNTLGIGPGDTIQLERARS"
     MSRLPNLVTF ITDFGLDWGP VGICHAVMRG INPQISIVDI SHGIPAFDIR AGAWVLTSIF        60
     PYVPPAVHVV VVDPGVGTQR LPIAILCRRG DVLIGPDNGV LIPATRRLGG IVEARKISNK       120
     ALMRPDISYT FHGRDIFCPV AAHLSSGVSF EDVGEILPIS DLVQAPWREP EIYEHRVVAE       180
     VAILDKFGNI RTNIEAADWP LSTGEKIILK HKNNQVNLAV ARTFGEVNRG DLLIYEDSSR       240
     FICIGQNLGH AGNTLGIGPG DTIQLERARS                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page