(data stored in ACNUC7421 zone)

EMBL: CP001825.PE561

CP001825.PE561       Location/Qualifiers
FT   CDS             624614..625579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0567"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; SH3 type 3
FT                   domain protein; KEGG: sfr:Sfri_1626 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41485"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX9"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACZ41485.1"
FT                   /translation="MSKIRIFNASFWLIFVMAFSFFINACGGNANSSAGIPSPTARSQE
FT                   VVASSPTPAPSPSVYEATQPTPTADGVVASPSPTPAQASPANTPPKESSTKYTRTMYVD
FT                   GIREGYVGVNLRARPSTESQSLLVIKNREPVRTTKGPMQGADGNLWFPASYNGKEGYIL
FT                   ATLLSAQRPAPPPVRLIIKNDRLDVDAAVEYVGLTPDGAMDVPKKWEDVAWYRLGPVPG
FT                   QQGNAVIAGHLDSTTGPAVFWKLKDIRIGDVVSVIDEDGHKINFKVTKIQSYFDEDAPL
FT                   YDIFGPTDKSRLNLITCDGSWDPKAKRYDKKLVVFTEKIS"
     MSKIRIFNAS FWLIFVMAFS FFINACGGNA NSSAGIPSPT ARSQEVVASS PTPAPSPSVY        60
     EATQPTPTAD GVVASPSPTP AQASPANTPP KESSTKYTRT MYVDGIREGY VGVNLRARPS       120
     TESQSLLVIK NREPVRTTKG PMQGADGNLW FPASYNGKEG YILATLLSAQ RPAPPPVRLI       180
     IKNDRLDVDA AVEYVGLTPD GAMDVPKKWE DVAWYRLGPV PGQQGNAVIA GHLDSTTGPA       240
     VFWKLKDIRI GDVVSVIDED GHKINFKVTK IQSYFDEDAP LYDIFGPTDK SRLNLITCDG       300
     SWDPKAKRYD KKLVVFTEKI S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page