(data stored in ACNUC7421 zone)

EMBL: CP001825.PE562

CP001825.PE562       Location/Qualifiers
FT   CDS             complement(625597..626898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0568"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: bha:BH2135 glycolate oxidase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41486"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY0"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACZ41486.1"
FT                   /translation="MCPSSNTLQSWDELDPPAYDIINACVQCGLCLSVCPTYLLTFKET
FT                   SSPRGRIHLLKAVWEGKLDARDPILDHQMYECLDCRACEAICPSGVRYGVLVESARAQL
FT                   ERKHPRSLWVRALRWIVFNKLFASMALFRAFSRALWLYQRIGLSRIARSTRILDILHLA
FT                   DKEALLPQIPSKFFVPEDQALPPKGNKRFRVGLFAGCIMSTAFAEIDRATIRVLQHNGC
FT                   EVVVPKRQGCCGALNVHSGERRSATEMMKANIQAFERLDLDYIIVNSAGCGATLKEYPH
FT                   FFKDDPGWHERAKHFSSLVRDVSEFLSEVGMSGPNRAVPVRVTYQDPCHLAHAQKVYRQ
FT                   PRELLASIPGVELVEMQESKLCCGSAGIYNITNPEISNQLLERKLEHALATGAEVIVSA
FT                   NPGCMLQLQKGLRHRGLDIQVKHLVQILDQAYGD"
     MCPSSNTLQS WDELDPPAYD IINACVQCGL CLSVCPTYLL TFKETSSPRG RIHLLKAVWE        60
     GKLDARDPIL DHQMYECLDC RACEAICPSG VRYGVLVESA RAQLERKHPR SLWVRALRWI       120
     VFNKLFASMA LFRAFSRALW LYQRIGLSRI ARSTRILDIL HLADKEALLP QIPSKFFVPE       180
     DQALPPKGNK RFRVGLFAGC IMSTAFAEID RATIRVLQHN GCEVVVPKRQ GCCGALNVHS       240
     GERRSATEMM KANIQAFERL DLDYIIVNSA GCGATLKEYP HFFKDDPGWH ERAKHFSSLV       300
     RDVSEFLSEV GMSGPNRAVP VRVTYQDPCH LAHAQKVYRQ PRELLASIPG VELVEMQESK       360
     LCCGSAGIYN ITNPEISNQL LERKLEHALA TGAEVIVSAN PGCMLQLQKG LRHRGLDIQV       420
     KHLVQILDQA YGD                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page