(data stored in ACNUC7421 zone)

EMBL: CP001825.PE563

CP001825.PE563       Location/Qualifiers
FT   CDS             626973..627941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0569"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pat:Patl_3506 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41487"
FT                   /db_xref="GOA:D1CEY1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY1"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACZ41487.1"
FT                   /translation="MKVIIDCDMGIDDAIAVAYALALQDVDVLGIGSVHGNIEADVAAE
FT                   NTLKLLKVMNRTDIPVAVGAPKPMIRPLSMAKFVHGEDGLGNANFAPSGLVPSDEHAAD
FT                   QIIRLARENPGEITLITTGPLTNAAIALLKEPKLPQLIPHVVVMGGTVEHPGNVGPVSE
FT                   ANIAHDPEAAQIVFSAPWKVTMVGLDVTMKTLLLEQHLDAWKQARTPLTEWLLRIVPFY
FT                   MQFYSQSLGYMACAMHDALAVGIAVGKVEVSESVTCPVWVNTVVGPGLGQTVADRRSES
FT                   MRATSEPYYFIGESNTEVIMKVDGDAFVSHLVDSIASYQVR"
     MKVIIDCDMG IDDAIAVAYA LALQDVDVLG IGSVHGNIEA DVAAENTLKL LKVMNRTDIP        60
     VAVGAPKPMI RPLSMAKFVH GEDGLGNANF APSGLVPSDE HAADQIIRLA RENPGEITLI       120
     TTGPLTNAAI ALLKEPKLPQ LIPHVVVMGG TVEHPGNVGP VSEANIAHDP EAAQIVFSAP       180
     WKVTMVGLDV TMKTLLLEQH LDAWKQARTP LTEWLLRIVP FYMQFYSQSL GYMACAMHDA       240
     LAVGIAVGKV EVSESVTCPV WVNTVVGPGL GQTVADRRSE SMRATSEPYY FIGESNTEVI       300
     MKVDGDAFVS HLVDSIASYQ VR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page