(data stored in ACNUC7421 zone)

EMBL: CP001825.PE565

CP001825.PE565       Location/Qualifiers
FT   CDS             complement(629187..629555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41489"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_1829"
FT                   /protein_id="ACZ41489.1"
FT                   /translation="MKVAYIFSTSGHTVSYKLGKMILPQLEEDRHGAEVIGMFFFDDNT
FT                   YMLRKGDPVGERLSKVAKDKGIMLMLCDQCAVERGLAEIGPDGKCYPKDVVEGVQVGCF
FT                   PDLYAALGNNPPDQVITL"
     MKVAYIFSTS GHTVSYKLGK MILPQLEEDR HGAEVIGMFF FDDNTYMLRK GDPVGERLSK        60
     VAKDKGIMLM LCDQCAVERG LAEIGPDGKC YPKDVVEGVQ VGCFPDLYAA LGNNPPDQVI       120
     TL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page