(data stored in ACNUC7421 zone)

EMBL: CP001825.PE57

CP001825.PE57        Location/Qualifiers
FT   CDS             complement(59592..61076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0058"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: gbm:Gbem_3644 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40981"
FT                   /db_xref="GOA:D1CDH5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH5"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACZ40981.1"
FT                   /translation="MKHRDNRDLVDLSIRELRKLLDNKHVSSVELTEAYLRRIEQVDPQ
FT                   IRSYLTVTADLALQQAQEADKKLASGEKSPLLGIPMALKDIISTKGIKTTCGSKMLENY
FT                   IPPYDATVYEKLCAAGCVLLGKLNMDEFAMGSSTENSAYGPTKNPWDLTTVPGGSSGGS
FT                   ASAVAAGEAAFTLGSDTGGSVRQPAALCGVVGLKPTYGRVSRYGLVAFASSLDQIGPIT
FT                   RTVEDLADVLQVIAGYDPKDSTSVPIDVPQYGDALSEDIRGIRIGVPKEYFVEGMEPGV
FT                   ERAVREAIDKLGSLGAKIVDISLPSTDYALATYYIIAPAEASSNLSRYTGVEYGHRAPD
FT                   AEDIIDMYMKTREEGFGPEVKRRIMLGTYVLSAGYYDAYYLKAQKVRTIIKSEFDAAFK
FT                   ECDVIATPTSPTVAFKLGSKLQDPLSMYLSDLFTIPANMAGIPGLSIPCGFSDDLPVGL
FT                   QLLGKAFDESTLLKVGYAYQQSTEWHLKRPQILAYL"
     MKHRDNRDLV DLSIRELRKL LDNKHVSSVE LTEAYLRRIE QVDPQIRSYL TVTADLALQQ        60
     AQEADKKLAS GEKSPLLGIP MALKDIISTK GIKTTCGSKM LENYIPPYDA TVYEKLCAAG       120
     CVLLGKLNMD EFAMGSSTEN SAYGPTKNPW DLTTVPGGSS GGSASAVAAG EAAFTLGSDT       180
     GGSVRQPAAL CGVVGLKPTY GRVSRYGLVA FASSLDQIGP ITRTVEDLAD VLQVIAGYDP       240
     KDSTSVPIDV PQYGDALSED IRGIRIGVPK EYFVEGMEPG VERAVREAID KLGSLGAKIV       300
     DISLPSTDYA LATYYIIAPA EASSNLSRYT GVEYGHRAPD AEDIIDMYMK TREEGFGPEV       360
     KRRIMLGTYV LSAGYYDAYY LKAQKVRTII KSEFDAAFKE CDVIATPTSP TVAFKLGSKL       420
     QDPLSMYLSD LFTIPANMAG IPGLSIPCGF SDDLPVGLQL LGKAFDESTL LKVGYAYQQS       480
     TEWHLKRPQI LAYL                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page