(data stored in ACNUC7421 zone)

EMBL: CP001825.PE58

CP001825.PE58        Location/Qualifiers
FT   CDS             complement(61066..61362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0059"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: bha:BH0665 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40982"
FT                   /db_xref="GOA:D1CDH6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH6"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACZ40982.1"
FT                   /translation="MGLSSEQVLHISRLARLGLTDAEVELFRDQLSSIIEHVNKLSELD
FT                   TEAIPPTAQVIELLDVFAKDEPSTSYSTDEMLANAPEKEENCFKVITVLGYET"
     MGLSSEQVLH ISRLARLGLT DAEVELFRDQ LSSIIEHVNK LSELDTEAIP PTAQVIELLD        60
     VFAKDEPSTS YSTDEMLANA PEKEENCFKV ITVLGYET                                98
//

If you have problems or comments...

PBIL Back to PBIL home page