(data stored in ACNUC7421 zone)

EMBL: CP001825.PE59

CP001825.PE59        Location/Qualifiers
FT   CDS             complement(61408..62529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0060"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: sat:SYN_00550 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40983"
FT                   /db_xref="GOA:D1CDH7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH7"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ACZ40983.1"
FT                   /translation="MNSREEITTPWWRKFDWVLLLCTLALSSFGLVMIYSATSDPGPLT
FT                   LNPLVIRQFIYLIVGLLFMSIMATVDYRFLLNWKWVIYGLVLFLLTLVFVIGHTAYGST
FT                   RWIDLGPFPLQPSELAKLLMVLVLAGFLCEKKRGERDLKRLIISICIIAPPTALVFLQP
FT                   DLGTSMVLGAAWVSLVLFGGIPVKYLMRLFLLLIPFAVIGGRFLLKPYQIERIAIFLRP
FT                   EDNPFGSGYNIIQATISVGSGGFWGQGFMSGSQSQLHYLRVQHTDFIASVIGEEFGFIG
FT                   MMALLVVYGLLLWRIIRIASKARDKYGELIAVGVAAIILFQVFVNIGMNIQLMPVTGIP
FT                   LPFISYGGSSLVTLLTSEGILQSIILRHKKVNL"
     MNSREEITTP WWRKFDWVLL LCTLALSSFG LVMIYSATSD PGPLTLNPLV IRQFIYLIVG        60
     LLFMSIMATV DYRFLLNWKW VIYGLVLFLL TLVFVIGHTA YGSTRWIDLG PFPLQPSELA       120
     KLLMVLVLAG FLCEKKRGER DLKRLIISIC IIAPPTALVF LQPDLGTSMV LGAAWVSLVL       180
     FGGIPVKYLM RLFLLLIPFA VIGGRFLLKP YQIERIAIFL RPEDNPFGSG YNIIQATISV       240
     GSGGFWGQGF MSGSQSQLHY LRVQHTDFIA SVIGEEFGFI GMMALLVVYG LLLWRIIRIA       300
     SKARDKYGEL IAVGVAAIIL FQVFVNIGMN IQLMPVTGIP LPFISYGGSS LVTLLTSEGI       360
     LQSIILRHKK VNL                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page