(data stored in ACNUC7421 zone)

EMBL: CP001825.PE6

CP001825.PE6         Location/Qualifiers
FT   CDS             4723..6393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0006"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_3854 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40930"
FT                   /db_xref="GOA:D1CDC4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC4"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACZ40930.1"
FT                   /translation="MSRDKDYDVIVIGAGHNGLVCANYLAKAGCKVVVLERRPVVGGAS
FT                   ATEEMFGGYKIDVGSAVHTLIHETGIIDDLKLEKFGLKYLQLDPFAFAPFPDGTYLRFY
FT                   RDLDKTCEEIEKVSPKDAEAYKKFVEDWTELNRILTATFTSKPSAPSMSYKALSKDIVS
FT                   LLKMTARRSLQDRIHQLLMDYGKLLSMTFESEYVKAPLAFLAAQAGVSPSTPGTANFAG
FT                   WHALSHSTGVTRPQGGSGKLSEALQESLINMGGEVRLDTEVTSILIRNDRAIGVETSSR
FT                   EKFSSDIVISSVAPVKTLLELIPSEALNDNLRRKISSIKISPISGVYIRGIATNLPEYK
FT                   AVGGSDNKDHYMGMQLLCPTLSGLEKGFQEATIGNKPSKPAVYLLTPSVVDPSLAPEKH
FT                   LVYIWAQPYPLQLAGGQSWDDATQDVVADIFNATSEYIEGLVDIITKHRVIRTPPQLAG
FT                   DLQLPYSNIMHGDMTIDQLFFMRPIPELSGYRTPIKGLYLTGAGTHPGGGVQGAAGKNT
FT                   AEVILADMTKAKRWIKPALVVAGSSIAFAVLRRSARASN"
     MSRDKDYDVI VIGAGHNGLV CANYLAKAGC KVVVLERRPV VGGASATEEM FGGYKIDVGS        60
     AVHTLIHETG IIDDLKLEKF GLKYLQLDPF AFAPFPDGTY LRFYRDLDKT CEEIEKVSPK       120
     DAEAYKKFVE DWTELNRILT ATFTSKPSAP SMSYKALSKD IVSLLKMTAR RSLQDRIHQL       180
     LMDYGKLLSM TFESEYVKAP LAFLAAQAGV SPSTPGTANF AGWHALSHST GVTRPQGGSG       240
     KLSEALQESL INMGGEVRLD TEVTSILIRN DRAIGVETSS REKFSSDIVI SSVAPVKTLL       300
     ELIPSEALND NLRRKISSIK ISPISGVYIR GIATNLPEYK AVGGSDNKDH YMGMQLLCPT       360
     LSGLEKGFQE ATIGNKPSKP AVYLLTPSVV DPSLAPEKHL VYIWAQPYPL QLAGGQSWDD       420
     ATQDVVADIF NATSEYIEGL VDIITKHRVI RTPPQLAGDL QLPYSNIMHG DMTIDQLFFM       480
     RPIPELSGYR TPIKGLYLTG AGTHPGGGVQ GAAGKNTAEV ILADMTKAKR WIKPALVVAG       540
     SSIAFAVLRR SARASN                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page