(data stored in ACNUC7421 zone)

EMBL: CP001825.PE64

CP001825.PE64        Location/Qualifiers
FT   CDS             complement(66605..68131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0065"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: gsu:GSU0111 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40988"
FT                   /db_xref="GOA:D1CDI2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI2"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACZ40988.1"
FT                   /translation="MAIKTEEIAEIIKKQIESFGQPVVTAEVGTVVEVGDGIARAYGLS
FT                   GVKASELVQFENGVYGLALNLEEDNVGIVILGPYTDIEEGQQVRSTGRVVDVPVGDELI
FT                   GRVVNPLGEPIDGKGPINATKRRVIERIAPGVVARKSVDTPVQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKSAIAIDTIINQKGKDLICIYVAIGQKTSKVAQVVATLEEYGAMEHTI
FT                   VVAANADDPASLQYIAPYAGCAMGEEFMEQGRDALVVYDDLSKHAAAYREISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNDEYGGGSLTALPIIETQANDVSAYIPTNVISITDG
FT                   QIYLESDLFYAGIRPAINVGLSVSRVGGAAQTKAMRQVAGKLRLDLAQFRSLAAFAQFG
FT                   SDLDKATRAQLERGQRLTEVLKQPQYSPVPLERQVMIIFAATNGYLDDIPVDSVRDFEN
FT                   RFYEYMDSVHPEIGQEIADKKALSDELTEKLRAAIEEFKQGYTPQQSAPA"
     MAIKTEEIAE IIKKQIESFG QPVVTAEVGT VVEVGDGIAR AYGLSGVKAS ELVQFENGVY        60
     GLALNLEEDN VGIVILGPYT DIEEGQQVRS TGRVVDVPVG DELIGRVVNP LGEPIDGKGP       120
     INATKRRVIE RIAPGVVARK SVDTPVQTGI KAIDSMIPIG RGQRELIIGD RQTGKSAIAI       180
     DTIINQKGKD LICIYVAIGQ KTSKVAQVVA TLEEYGAMEH TIVVAANADD PASLQYIAPY       240
     AGCAMGEEFM EQGRDALVVY DDLSKHAAAY REISLLLRRP PGREAYPGDV FYLHSRLLER       300
     AARLNDEYGG GSLTALPIIE TQANDVSAYI PTNVISITDG QIYLESDLFY AGIRPAINVG       360
     LSVSRVGGAA QTKAMRQVAG KLRLDLAQFR SLAAFAQFGS DLDKATRAQL ERGQRLTEVL       420
     KQPQYSPVPL ERQVMIIFAA TNGYLDDIPV DSVRDFENRF YEYMDSVHPE IGQEIADKKA       480
     LSDELTEKLR AAIEEFKQGY TPQQSAPA                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page