(data stored in ACNUC7421 zone)

EMBL: CP001825.PE65

CP001825.PE65        Location/Qualifiers
FT   CDS             complement(68158..68697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0066"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: bha:BH3757 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40989"
FT                   /db_xref="GOA:D1CDI3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI3"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACZ40989.1"
FT                   /translation="MPSVGSSARRYAEAIFELAQESGNLDAWHADLSLLASVFSDVSAL
FT                   RFFKNPRKSISEKQDMAKRLFEGKVQPQAMYLLQMLVDRDRVEIVPAILSRFEELLREA
FT                   RGIVVAEVTTAVPVDDNEKQQIVEQLSQITGKQIELHTKVDPSIIGGIVVRVGDKLVDG
FT                   SVATALTQLHRSLTLR"
     MPSVGSSARR YAEAIFELAQ ESGNLDAWHA DLSLLASVFS DVSALRFFKN PRKSISEKQD        60
     MAKRLFEGKV QPQAMYLLQM LVDRDRVEIV PAILSRFEEL LREARGIVVA EVTTAVPVDD       120
     NEKQQIVEQL SQITGKQIEL HTKVDPSIIG GIVVRVGDKL VDGSVATALT QLHRSLTLR        179
//

If you have problems or comments...

PBIL Back to PBIL home page